PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco013398.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family BBR-BPC
Protein Properties Length: 319aa    MW: 34244.2 Da    PI: 10.1408
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco013398.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind310.36.5e-9513181301
    GAGA_bind   1 mdddgsre.rnkgyyepaaslkenlglqlmssiaerdaki.......rernlalsekkaavaerd..........maflqrdk..alaernkalverd 78 
                  md+dg    rn+g+y+p   +k nlglql s+ aerdak          +n    + +a + +rd          m++ +rd   + a++ +++++++
  Aco013398.1   1 MDEDGGLGlRNWGFYDPP--VKGNLGLQLSSVAAERDAKKppplplpLLSNG-GGGGSAGFLHRDcvvpepsvpmMDY-MRDGagWGAHHPHHHHQHQ 94 
                  999999999********9..9******************9899888734444.4567788899999999999**9999.6664125555444444444 PP

    GAGA_bind  79 nkllalllvensla...salpvgvqvlsg.tksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkp..kekkakkkkkk 170
                  ++  +  ++++       a++++  +l++  ++++++    +pql +++ e+++ e   a+ +    +  +e + +kkr  +++p  k +k +k+kk 
  Aco013398.1  95 HQHHHHHHQQHPNYggaAAAAAAAAMLPNiMHTLHMMPAPPQPQLPEPPLEAPKDEDRVAPALAP--PMPDEPPPSKKRLGGARPshKPPKPRKPKKA 190
                  444444444443335556666667777662566777788888*********99999877777655..4555555555555555541155666677774 PP

    GAGA_bind 171 sekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkkl 268
                   + +   ++++++ ++s+ ++ks+d+v+ng++lD+s++P+PvCsCtGa +qCY+WG+GGWqSaCCtt+iS+yPLP+s+kr+gaRiagrKmSqgafkk+
  Aco013398.1 191 AAFP---ESPNGSTSSSRGKRKSTDMVINGIDLDISRIPTPVCSCTGAAQQCYRWGAGGWQSACCTTSISMYPLPMSAKRKGARIAGRKMSQGAFKKV 285
                  4444...3344444789********************************************************************************* PP

    GAGA_bind 269 LekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                  LekLa+eGy+lsnp+DLk++WAkHGtnkfvtir
  Aco013398.1 286 LEKLAGEGYNLSNPIDLKTFWAKHGTNKFVTIR 318
                  ********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012262.7E-1291318IPR010409GAGA-binding transcriptional activator
PfamPF062171.3E-981318IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MDEDGGLGLR NWGFYDPPVK GNLGLQLSSV AAERDAKKPP PLPLPLLSNG GGGGSAGFLH  60
RDCVVPEPSV PMMDYMRDGA GWGAHHPHHH HQHQHQHHHH HHQQHPNYGG AAAAAAAAAM  120
LPNIMHTLHM MPAPPQPQLP EPPLEAPKDE DRVAPALAPP MPDEPPPSKK RLGGARPSHK  180
PPKPRKPKKA AAFPESPNGS TSSSRGKRKS TDMVINGIDL DISRIPTPVC SCTGAAQQCY  240
RWGAGGWQSA CCTTSISMYP LPMSAKRKGA RIAGRKMSQG AFKKVLEKLA GEGYNLSNPI  300
DLKTFWAKHG TNKFVTIR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6608981e-152KM660898.1 Ananas bracteatus clone 39211 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010936844.11e-109PREDICTED: protein Barley B recombinant
RefseqXP_010936843.11e-109PREDICTED: protein Barley B recombinant
SwissprotP0DH886e-86BBRA_ORYSJ; Barley B recombinant-like protein A
SwissprotP0DH896e-86BBRB_ORYSJ; Barley B recombinant-like protein B
TrEMBLM0RQS44e-98M0RQS4_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P09440_0011e-97(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22113697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.31e-60basic pentacysteine 2